Protein Info for Dshi_0748 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 26 to 174 (149 residues), 106.6 bits, E=8.4e-35

Best Hits

Swiss-Prot: 73% identical to LOLD_RUEPO: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to dsh:Dshi_0748)

MetaCyc: 48% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

See A8LQV0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Dshi_0748 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MSEPVLVLDGITKTYNAGTPGEIAVLRGASLSVAPGEVVALVAPSGSGKSTLLHIAGLLD
VPDAGTVTLAGTAVAGLPDRTRTALRRREVGFIYQFHHLLPEFDAAENVILPQLADGVPE
ADARARAEGLLASVGLGARLTHRPAALSGGEQQRVAFCRALANAPKVLLADEPTGNLDPA
TSDTVFDAMMAQVRETGLSAVIATHNMALAGRMDRVVRMENGVLSEG