Protein Info for Dshi_0746 in Dinoroseobacter shibae DFL-12

Annotation: MIP family channel protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details PF00230: MIP" amino acids 2 to 222 (221 residues), 161.7 bits, see alignment E=1.2e-51 TIGR00861: MIP family channel proteins" amino acids 7 to 222 (216 residues), 182.7 bits, see alignment E=4.5e-58

Best Hits

Swiss-Prot: 68% identical to AQPZ_BRUA2: Aquaporin Z (aqpZ) from Brucella abortus (strain 2308)

KEGG orthology group: K06188, aquaporin Z (inferred from 100% identity to dsh:Dshi_0746)

MetaCyc: 63% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQU8 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Dshi_0746 MIP family channel protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MFKRTLAEFIGTYWLVFGGCGAALLAAGVPEVGIGWVGVSLAFGLSVLTMAYAVGGISGG
HFNPAVTLGLTIAGRFEAKDIPPYWIAQLLGGAAAAGTLFVIMSGQAEFASVGSFASNGY
GVASPGGFGMMSGMIAEVVLTAVFVIVILGATSHMVPEGFAPIAIGLCLTLIHLISIPIT
NTSVNPARSTAMAIYADGPALGQLWLFWAAPLAGAVIGALIWAALDED