Protein Info for Dshi_0742 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function UPF0118 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 207 to 260 (54 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 302 to 333 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 334 (320 residues), 203.9 bits, see alignment E=2.2e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0742)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQU4 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Dshi_0742 protein of unknown function UPF0118 (RefSeq) (Dinoroseobacter shibae DFL-12)
MALPVRQQVLSWSIAALVFLALLWLLGDVILPFVVGGAIAYFLDPVADRLEAMGLSRTIS
TAIIALVAVFVFIIAALLIIPTLIQQTIALGEAIPQILSQLQAFLSERFPSLNDPESTIR
ESLATLGEMIRSRSGELVNKVFASALGVINAVIFIIVCPVVAFYLLLDWDNMVARIDDLL
PLDHKATIRKLAGEVDGVMAGFVRGQLTVCLILGTFYSIALMLVGLQFGLVVGAVAGLLT
FIPYVGSLVGGTLSIGLAIFQFWGDPGWIVAVALIFILGQMIEGNYLTPKLVGDSVGLHP
VWLLFALSAFGTAFGFVGMLVAVPVSAMIGVLVRFAIGQYRGGLLYRGLSGSRPPPDEEA
R