Protein Info for Dshi_0714 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF6 transmembrane (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 112 (18 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF00892: EamA" amino acids 32 to 163 (132 residues), 59.3 bits, see alignment E=5.2e-20 amino acids 172 to 302 (131 residues), 49.9 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0714)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQH3 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dshi_0714 protein of unknown function DUF6 transmembrane (RefSeq) (Dinoroseobacter shibae DFL-12)
MWRPRGSARLLHSPRIPWHANAMTDSQSRPLAGMLWMVATGVSFVAVTALVKSIGSDIPA
AQAAFLRYVLGLVFILPVLASLLRTLPSRANLSIFALRGLIHTGAVIAWFFAMTQIPIAE
VTAMNYFSPVYVTIGAALFLGEKLAARRIAAICVALLGALIILRPGFRELSPGHFAMLGT
ALGFAISYLLAKRLVRDLSPGLVVAWLSIFVSIGLAPFAIAVWVTPSPWHLVVLFGVACF
ATLGHYTMTRAFQAAPMSVTQPVTFLQLVWATALGALVFGEAVDGFVVLGGGLIVAAISF
LSWREARLRRGVITPSVSEPKT