Protein Info for Dshi_0687 in Dinoroseobacter shibae DFL-12

Annotation: binding-protein-dependent transport systems inner membrane component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 236 (159 residues), 90.8 bits, see alignment E=4.8e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to dsh:Dshi_0687)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQE7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Dshi_0687 binding-protein-dependent transport systems inner membrane component (RefSeq) (Dinoroseobacter shibae DFL-12)
MDIKAKTEKTRTTLISLVMLGIAWQLAALGLADSSVLPPPAEVWAILVGEWRSGELVFHI
TQTLQRVAAAFFLAMGIGSVIGVVLGKMPALDRWLDPWVVFFLNLPALVVIVLCYLWIGL
NETAAIVAVALNKTAMVIVIMREGVRSLDPDVAEMARVYRFSAWKRLRHVLIPQLAPFIS
TAVRNGLAVIWKIVLVVEFLGRSNGVGFQIHLYFQLFETGYVLAYALSFVAVMLALEYAL
VQPWEARARKWRRVQTPA