Protein Info for Dshi_0665 in Dinoroseobacter shibae DFL-12

Annotation: Cytochrome c oxidase cbb3 type accessory protein FixG (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 26 to 476 (451 residues), 553.8 bits, see alignment E=1.5e-170 PF12801: Fer4_5" amino acids 87 to 121 (35 residues), 28.6 bits, see alignment 4e-10 PF13746: Fer4_18" amino acids 209 to 310 (102 residues), 124.9 bits, see alignment E=6.2e-40 PF11614: FixG_C" amino acids 351 to 476 (126 residues), 87.1 bits, see alignment E=3.7e-28

Best Hits

Swiss-Prot: 69% identical to RDXB_RHOS4: Protein RdxB (rdxB) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0665)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQC5 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Dshi_0665 Cytochrome c oxidase cbb3 type accessory protein FixG (RefSeq) (Dinoroseobacter shibae DFL-12)
MSSVEEPKSLYAPREPIFPRRVKGTFRSLKWWIMLVTLGVYYITPWIRWDRGPNLPDQAV
LVDLANRRFYFFVIEIWPHEFYFVAGLLIMAGLGLFLFTSAMGRVWCGYACPQTVWTDLF
IAVERWIEGDRNNRLRLHRAPMSARKLRLRLTKWTIWLVIAVATGGAWVFYFTDAPTLLR
DLVTFSAHPVAYTTIAILTATTFVFGGFAREQICIYACPWPRIQAAMMDEDTLTIGYRDW
RGEPRGKHRKAEGAEEKGDCIDCMACVNVCPMGIDIRNGQQMECITCGLCIDACDDIMEK
IGKPRGLIDYLALSDETLERAGKTGRRPWQHILRPRTILYTVLWAGVGVGLVVALFLRSD
IEMTVAPVRNPTFVTLANGDIRNTYEVRLLNKHGEDRRFDLTVEAQDPAAAELMLDIEGS
DTNWVMVPADSTQLSRVYVIGPRGSDAVENHRTEFRLWVEDLSTGERAYKDTVFNGKGSQ