Protein Info for Dshi_0624 in Dinoroseobacter shibae DFL-12

Annotation: Ferric reductase domain protein transmembrane component domain (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 117 to 133 (17 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 178 to 194 (17 residues), see Phobius details PF01794: Ferric_reduct" amino acids 50 to 162 (113 residues), 67.8 bits, see alignment E=4.6e-23

Best Hits

Swiss-Prot: 48% identical to MSRQ_OCHA4: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0624)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPP7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dshi_0624 Ferric reductase domain protein transmembrane component domain (RefSeq) (Dinoroseobacter shibae DFL-12)
MVDGLNRAARKVPNWLFYVLGPLPAMWLLWQGIQGGLGVDPVKVIEHELGLIALQLLIAG
LAITPLRRFAGLNLIKWRRPIGVLAFSYVALHLATWVLLDMQLYWEQMLKDIAKRPYITI
GMVAFVLLVPLAWTSNNRSVRSMGAAAWSKLHRLVYPAVLLGAVHFVMVQKVWEAESLLY
LALTVGLLATRIKLPRRDTARA