Protein Info for Dshi_0603 in Dinoroseobacter shibae DFL-12

Annotation: thioesterase superfamily protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF13622: 4HBT_3" amino acids 36 to 112 (77 residues), 27 bits, see alignment E=4.2e-10 PF03061: 4HBT" amino acids 42 to 112 (71 residues), 64.1 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 53% identical to YCIA_SALTY: Acyl-CoA thioester hydrolase YciA (yciA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 100% identity to dsh:Dshi_0603)

MetaCyc: 52% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPM6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Dshi_0603 thioesterase superfamily protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MQVEEESNLDRAQKRVKHGRQQDDGVLVIRTVAMPADTNPAGDIFGGWLMSQMDLAAGNM
AGRVSQGRGATVAVEAMQFSRPVNVGDEVTIYASLVRMGRTSMRIHVDVWARPRFSNASV
KVTSADFVFVALDEDGKPRDIPT