Protein Info for Dshi_0593 in Dinoroseobacter shibae DFL-12

Annotation: putative rod shape-determining protein MreD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 75 (18 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 100% identity to dsh:Dshi_0593)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPL6 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Dshi_0593 putative rod shape-determining protein MreD (RefSeq) (Dinoroseobacter shibae DFL-12)
MGSAFEPKLWVLRVVFLALVAAVLIVALLPLSVAAPRIPGPDVVLCVILAWVLRRPDVLP
VTLIVAVVLVEDFLFQRPPGLWTLLVLVGSEVMRRQAYREGETPIAVEFGLVAATLTAMT
VAERVLLAIALVPQPAFSAQMLHLLSTLAIYPVVVLASVYLCGVRPRPTDGPRILGMRV