Protein Info for Dshi_0592 in Dinoroseobacter shibae DFL-12

Annotation: Peptidoglycan glycosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 17 to 607 (591 residues), 722.3 bits, see alignment E=2.3e-221 PF03717: PBP_dimer" amino acids 63 to 236 (174 residues), 145.5 bits, see alignment E=2.6e-46 PF00905: Transpeptidase" amino acids 269 to 603 (335 residues), 202.7 bits, see alignment E=7.9e-64

Best Hits

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 100% identity to dsh:Dshi_0592)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPL5 at UniProt or InterPro

Protein Sequence (647 amino acids)

>Dshi_0592 Peptidoglycan glycosyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MKRADKDMKLSARTITRRGLIVGGLQLGVLGALAVRMRELQVKEAEQYKFLAEENRINIR
LLPPARGLIYDRDGVLLAGNAPNYRVVIVREDAGDVDAVLRTLTDIVPLPEEDLARARRE
MGRRSPFVPVTISDRLTWEQFSEISINAPALPGIVTEVGLSRYYPLDQDFAHSIGYVGPV
SDFDLERLNDDDPLLQIPRFQIGKTGVEAKFEQALRGSAGSSQIEVNAAGRVMRELRRDE
GQPGANLQLTLDHALQNYTEARLAGESAAVVVMDIEDGDIRAIASAPSFDPNKFVRGISS
ADYRALLEDEYRPLADKTVQGTYPPGSTFKMLTALAALEAGVIDPGERVWCPGHYKLGTR
RFHCWKRGGHGWMNLVDSLRESCDVYYYDISQKVGVDKIAEMARRFGLGTRFDVPMSAVA
EGLMPNRAWKAANRGEAWQVGDTLNASIGQGFVLASPLQLAVMTARLATGREIMPRLIRA
VNDRPVARPDPAPLGIRRAHLEVIQRALYEVTNLRSGTAYGSRIAESTYRLAGKTGTSQV
RNITVEERARGVFRNEDLPWNRRDHALFVGYAPFDAPRYAVSVVVEHGGGGSKAAAPIAR
DVLLQALYGGLPPLSAYPAHQRNMIDERQRALELRPRQEPEQGRSRA