Protein Info for Dshi_0569 in Dinoroseobacter shibae DFL-12

Annotation: MotA/TolQ/ExbB proton channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 85 to 205 (121 residues), 104.4 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to dsh:Dshi_0569)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPJ2 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Dshi_0569 MotA/TolQ/ExbB proton channel (RefSeq) (Dinoroseobacter shibae DFL-12)
MIDLASLALLDLSALQSFMAQGGPAIWVIAGLSVITLTVILWKLWRFARIGAWSGQRADR
AVQHWVKGDMGAAHRALSGQQGVRARLVARALAALDDPGLSFEGAKEETYRIAQRELAQS
RAGLRVLELIATIAPLIGLLGTVLGMIAAFQALQDAGARADPGTLAGGIWEALLTTAAGM
AVAIPASMALSYFESVVDRIRQDMEDLATRIFIRAETRELTPKPLQRAAE