Protein Info for Dshi_0536 in Dinoroseobacter shibae DFL-12

Annotation: biotin/lipoyl attachment domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 1 to 70 (70 residues), 60.4 bits, E=4.9e-20
• PF02817: E3_binding
  • amino acids 113 to 147 (35 residues), 51.9 bits, 2.8e-17
• PF12146: Hydrolase_4
  • amino acids 167 to 298 (132 residues), 44.2 bits, E=5.9e-15
• PF00561: Abhydrolase_1
  • amino acids 170 to 386 (217 residues), 55.5 bits, E=2.7e-18
• PF00975: Thioesterase
  • amino acids 170 to 396 (227 residues), 45.8 bits, E=3.6e-15
• PF12697: Abhydrolase_6
  • amino acids 171 to 393 (223 residues), 72.9 bits, E=2.5e-23
• PF00151: Lipase
  • amino acids 214 to 267 (54 residues), 34 bits, 8.7e-12
• PF06821: Ser_hydrolase
  • amino acids 219 to 267 (49 residues), 27.1 bits, 1.4e-09

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 100% identity to dsh:Dshi_0536)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.12

Use Curated BLAST to search for 2.3.1.12 or 2.3.1.168

Sequence Analysis Tools

See A8LNX4 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Dshi_0536 biotin/lipoyl attachment domain-containing protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MPRLGETMEEATIADWLVQPGQSFKRGDPLLEVETDKTMVEYPALGDGILVETLVGPGDV
VEVGTPIAVIETRDAWDSVEEPDAAASSPGAAPSEVAGTAAQALVSPDAARLRATPLARR
IARENHIALSQVTGTGRRGRIEAGDVRVMLTEGASTPAVIQAAPGATASVYCVHGFAGLG
SNWAALRASLQRAGITSSAPDLPGHGRNRVDAGSIEALADWLAADLASQPEPVQLVGHSL
GAHVAARAAQRVPSRVARLTLLAPAGCGIEINGAFLSGMAAAPSVGELAHLMRLLGRKAA
ELDNHALEALSRELQGDRLSALAAAAARADVQRIDTIAPLRSLAGKIPVRAIFGLSDQII
PRDHAFHLPPAVACHMLEAGHMPHWDATEEVASIIAAP