Protein Info for Dshi_0523 in Dinoroseobacter shibae DFL-12

Annotation: L-fuculose-phosphate aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to FUCA_ECOLI: L-fuculose phosphate aldolase (fucA) from Escherichia coli (strain K12)

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 100% identity to dsh:Dshi_0523)

MetaCyc: 45% identical to L-fuculose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
L-fuculose-phosphate aldolase. [EC: 4.1.2.17]; 4.1.2.17 [EC: 4.1.2.17]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

lactate biosynthesis (archaea) (3/5 steps found)
superpathway of fucose and rhamnose degradation (8/12 steps found)
D-arabinose degradation II (2/4 steps found)
L-fucose degradation I (2/4 steps found)
nucleoside and nucleotide degradation (halobacteria) (2/6 steps found)
superpathway of pentose and pentitol degradation (15/42 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNW1 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Dshi_0523 L-fuculose-phosphate aldolase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTPATPLPDTTATRQALIDACLWMNARHLNQGTSGNISARIASGILITPSGVPYEYLTPD
ALVTIPLDGLPDSNGAQPSSEWPFHQGMHQARPDMPVVLHAHPPYCSVLAVQRRSIPACH
YMIAAFGGNDVPLADYALFGSPELCANMARIMADRHGCLMANHGATVLGETVDKARWRLE
ELETLARTYLFSSIGGAPHILSDAEIAEVMVAFSSYGPRHPEERNGEGERS