Protein Info for Dshi_0521 in Dinoroseobacter shibae DFL-12

Annotation: eIF-2B alpha/beta/delta-related uncharacterized protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 68% identical to MTNA_OCHA4: Methylthioribose-1-phosphate isomerase (mtnA) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 100% identity to dsh:Dshi_0521)

MetaCyc: 61% identical to methylthioribose-1-phosphate isomerase (Escherichia coli ATCC 25922)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]; 5.3.1.23 [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

5'-deoxyadenosine degradation I (2/3 steps found)
5'-deoxyadenosine degradation II (2/4 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (1/7 steps found)
L-methionine salvage cycle II (plants) (3/11 steps found)
L-methionine salvage cycle III (3/11 steps found)
L-methionine salvage cycle I (bacteria and plants) (3/12 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNV9 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Dshi_0521 eIF-2B alpha/beta/delta-related uncharacterized protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MKIDGTHYRSLWWNHEQNVLEIIDQRWLPHDFRVVPVATMQDFADAIYQMRVRGAPLIGA
TAAYGMALAMAEDPSDANMDAAWSFLEKTRPTAINLRWALDRCRAALRPLPQADRAAAAL
TLAHDIADEDVEINRRIGEHGLALIREIAACKPEGEPVRLLTHCNAGWLATVDWGTATSP
MYHAHDAGVPLQVWVDETRPRNQGALTAWELGKHGVPHTYITDNAGGHLMQHGLVDMVIT
GTDRTTRQGDVCNKIGTYLKALAARDNGVPFYVALPSPTIDWTVRDGVAEIPIEERDAFE
VTHVQGITGTGEIGMVQVTPDGTSGGNPAFDVTPNRLVTGLITERGVCNASAEGLASLFP
EFSKAAE