Protein Info for Dshi_0520 in Dinoroseobacter shibae DFL-12

Annotation: 5-methylthioribose kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF01636: APH" amino acids 38 to 276 (239 residues), 56.2 bits, see alignment E=2.3e-19 TIGR01767: S-methyl-5-thioribose kinase" amino acids 40 to 410 (371 residues), 432.4 bits, see alignment E=8.6e-134

Best Hits

KEGG orthology group: K00899, 5-methylthioribose kinase [EC: 2.7.1.100] (inferred from 100% identity to dsh:Dshi_0520)

Predicted SEED Role

"5-methylthioribose kinase (EC 2.7.1.100)" in subsystem Methionine Salvage (EC 2.7.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNV8 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Dshi_0520 5-methylthioribose kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MGAGTAYEALTVETLPERLRGVSALASRVGNDPGAWQVEEVGDGNLNLVFIVSGPSGKVI
VKQALPYVRLVGDSWPLPLYRAYFEYHALTRQAARDPGAVPTVYHFDEAQALIIMEYLSP
HVILRRKLIAGEHVAGLAAFLGRFCARTAFRGSELSMPSPEKKADVALFAGNVEIPAITE
ALVFTDPYFDAEMNSHTEGLEPVIARLRADVGLKVKVQQALQRFVSNTETMVHGDLHSGS
IMSTDSDSRVIDPEFVQYGPLGFDIGMLCANFLMAYFSQPAHRGEDLATYQEWILSVIAD
TCSVFEAEFRDLWRSERTGILYPQTLFEDQGQDSTPACDAVLAEIWRDAWAVCGIEMHRR
CLSLAHNADFEDIADVRVRAPLEARNLLMGAELIHSAATLADAKAVCALARDFNRKDVL