Protein Info for Dshi_0505 in Dinoroseobacter shibae DFL-12

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF13247: Fer4_11" amino acids 52 to 125 (74 residues), 32.7 bits, see alignment E=2.6e-11 PF12837: Fer4_6" amino acids 79 to 102 (24 residues), 30.1 bits, see alignment (E = 1.1e-10) PF12797: Fer4_2" amino acids 80 to 99 (20 residues), 25.9 bits, see alignment (E = 2.4e-09) PF13237: Fer4_10" amino acids 82 to 123 (42 residues), 28.1 bits, see alignment 5.3e-10 PF00037: Fer4" amino acids 84 to 102 (19 residues), 29.8 bits, see alignment (E = 1.3e-10) PF12838: Fer4_7" amino acids 86 to 157 (72 residues), 31 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 64% identical to FDHB_WOLSU: Formate dehydrogenase iron-sulfur subunit (fdhB1) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to dsh:Dshi_0505)

Predicted SEED Role

"Formate dehydrogenase-O, iron-sulfur subunit (EC 1.2.1.2); Putative formate dehydrogenase iron-sulfur subunit (EC 1.2.1.2)" (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNU5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Dshi_0505 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MARMKFLCDADRCIECNACVTACKNEHEVPWGINRRRVVTINDGLPGERSVSMACMHCTD
APCAAVCPVDCFYTTDDAVVLHSKDTCIGCGYCFYACPFGAPQYPKVGNFGTRGKMDKCT
YCAGGPEADMTEAEYVKYGSNRLAEGKLPLCAEMCSTKSLLAGDGDIIAEIYKERVVTRG
YGSGAWGWRSAYGDTVTV