Protein Info for Dshi_0494 in Dinoroseobacter shibae DFL-12

Annotation: NnrS family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF05940: NnrS" amino acids 23 to 397 (375 residues), 257.6 bits, see alignment E=1.2e-80

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to dsh:Dshi_0494)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNT4 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Dshi_0494 NnrS family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MSCGPATGRSRPLPRGPLATLGDEGFRLFFLLGALYAAQFPALWVLAWGLDLPMAQDVPP
ALWHAHEMLIGAFGAALIGFVTTAAPEWTDTEPPRGRPLWALAGLWAVGRTVGLFGWDAF
GAVGALADLGWMCALTVWLGVLSIRRRTDRLVAFIAWLAILTVCTAVGHFGFATGNLTLA
TQSIHLAGFALLGLLGLALSRITAPVTNLVLDPTERTSPFRPHPGRLHLAPGLVLVVMAG
DLLGVSPAVSAWLLVAAGAAFMDRVGEAFIGREIAMAEILLLAGSSALAGLGLILAGAAR
LGAPWPEVTGLHIAFMGGLGLGVYAVYCIAGLLHTGRPLGLSRAARLGAGMLVASVMLRV
APDLGLSLPLPAPALASGTWTAAFLLWAIAYWPALSRVALPEGPPDRAASKPHLPAAPVR
FPEAAE