Protein Info for Dshi_0484 in Dinoroseobacter shibae DFL-12

Annotation: 40-residue YVTN family beta-propeller repeat protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03866: PQQ-dependent catabolism-associated beta-propeller protein" amino acids 15 to 322 (308 residues), 499.7 bits, see alignment E=2.8e-154 PF10282: Lactonase" amino acids 26 to 121 (96 residues), 22.9 bits, see alignment E=1.2e-08 amino acids 179 to 304 (126 residues), 30.2 bits, see alignment E=7.1e-11 PF00400: WD40" amino acids 55 to 79 (25 residues), 13.2 bits, see alignment (E = 2.9e-05) TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 102 to 140 (39 residues), 45.7 bits, see alignment 4.9e-16 amino acids 281 to 320 (40 residues), 43.8 bits, see alignment 1.9e-15 PF21783: YNCE" amino acids 240 to 322 (83 residues), 27.4 bits, see alignment E=5.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0484)

Predicted SEED Role

"FIG01025517: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNS4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Dshi_0484 40-residue YVTN family beta-propeller repeat protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MKTILLSVAILALGTAQGLAGRAFVSNERGNTITVVNTDTWEVETEFFAGNRPRGITVSP
DEKVIYVCASDDNLIRVFDATTYEELPSLPSGPDPELFILEPSGKRLYIANEDDNLVTVT
DTETRMVLAEVPVGVEPEGMGMSPDAKWVVNTSETTNMAHFISTEDYKIKHNILVDQRPR
YAHYTSDGTRLFVTSEIGGTVSVMDIDEDGAPTVVGKISFEVAGLQPEWLQPVGARVTKD
GSRLFVALGPANRVAVVDARSLEVLDYILVGQRVWQLDFTPDEKYLLTTNGNSNDITVID
VEKERAIRSIQVGQQPWGVVTVN