Protein Info for Dshi_0459 in Dinoroseobacter shibae DFL-12

Annotation: von Willebrand factor type A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF00092: VWA" amino acids 92 to 274 (183 residues), 62.2 bits, see alignment E=7.7e-21 PF13519: VWA_2" amino acids 94 to 204 (111 residues), 58 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to dsh:Dshi_0459)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNP9 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Dshi_0459 von Willebrand factor type A (RefSeq) (Dinoroseobacter shibae DFL-12)
MFELAAPWILLLLPLPLVALRALRSAQVTGGALLVPDRVGAALISAGRPKGPAQMLTPRN
AALWLIWALVLLAISGPRDLAPVSALKVSGRDLAIVLDLSGSMVRDDFNLDDRAVTRLEA
VKAVGADFARRRAGDRLALVVFGSEAYFASPFTFDTESVARRIEEATIGISGRATSISDG
LGLALKRLSTSTATSRVVILLSDGINNAGATNPRGVAELAARYGVRVHTIALGPKDLTTA
EVGERGVVDAATLRAISQISGGESFRVRTTEDLVAVTEALDRLEATDGDGLAAEVYREYW
VWPASLALVIGVWFGWRELS