Protein Info for Dshi_0450 in Dinoroseobacter shibae DFL-12

Annotation: coenzyme PQQ biosynthesis protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 32 PF08042: PqqA" amino acids 2 to 20 (19 residues), 44.3 bits, see alignment E=6.6e-16 TIGR02107: coenzyme PQQ precursor peptide PqqA" amino acids 3 to 20 (18 residues), 37.8 bits, see alignment E=6.4e-14

Best Hits

Swiss-Prot: 100% identical to PQQA_DINSH: Coenzyme PQQ synthesis protein A (pqqA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0450)

Predicted SEED Role

"Coenzyme PQQ synthesis protein A" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN54 at UniProt or InterPro

Protein Sequence (32 amino acids)

>Dshi_0450 coenzyme PQQ biosynthesis protein A (RefSeq) (Dinoroseobacter shibae DFL-12)
MAWTKPIIREIECGMEINMYGPDSDEEREVLF