Protein Info for Dshi_0449 in Dinoroseobacter shibae DFL-12

Annotation: two component transcriptional regulator, winged helix family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 6 to 114 (109 residues), 68.7 bits, see alignment E=4.9e-23

Best Hits

Swiss-Prot: 36% identical to MPRA_MYCBO: Response regulator MprA (mprA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0449)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN53 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Dshi_0449 two component transcriptional regulator, winged helix family (RefSeq) (Dinoroseobacter shibae DFL-12)
MTSRLLIVEDDPEITSALVRGLALHGYEAEAENRADRALSRLTAGIYSGAIVDVMLGSDS
GVELVRTARAHGATLPILMLSALSGVEDRATGLAAGADDYVVKPFHFDELVARLRVQEHR
ALAQRVSPARLIRTSRRLEMGPDSVTLTEREFDLLALLIRSGEDPQPRSQLHATLWAAEG
ASTENVVDVYVGYLRRKLETADFGFEIKTVRNRGFCISGRRPELLES