Protein Info for Dshi_0448 in Dinoroseobacter shibae DFL-12

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 196 to 218 (23 residues), see Phobius details PF00672: HAMP" amino acids 223 to 268 (46 residues), 32 bits, see alignment 1.9e-11 PF00512: HisKA" amino acids 306 to 368 (63 residues), 58.2 bits, see alignment E=1e-19 PF02518: HATPase_c" amino acids 414 to 530 (117 residues), 74.3 bits, see alignment E=1.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0448)

Predicted SEED Role

"FIG00799423: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN52 at UniProt or InterPro

Protein Sequence (536 amino acids)

>Dshi_0448 integral membrane sensor signal transduction histidine kinase (RefSeq) (Dinoroseobacter shibae DFL-12)
MTSAPARPSMSLKLRLSLGAALLAAATVLTSSILYFGLNEVADRLDTALASERRMARYAT
ASTQAATFLVIASEAVQAGLPTEVRRERILQVVGQLQETFTLLHADVEEAVFSARALGID
GQSRYGTQSLGIARMEATLDQTVRGLLTDTQDTERLRGYIDSFATSFDPLLGQAINTERL
FRSEILSGIEALRIQLAWMALGIALAAGLSVAAFYFGLVRPQFYRLDAVRSAADQIGRGD
FSGVLPVSRLDEIGQLSQQTNRMAAALSDRQAKVDAEWTQLNEIIATRTKELKQANARLE
KTDEDRRRFFADVSHELRTPLTVILMEAQIGRQSIPAAADAFATIEARAERLNRKIDDLL
RLARSETGQLALACVPVALDALVASAIEEVQAELDNAGMTLDLVPFRETQVRADPDWLRQ
VLVSLVRNAIRHARSGEKLRIAPVVQRTQAGVSITDNGPGIPASRQYQVFERFSQGAGAT
SAQGFGIGLALARWVIDAHGGEISLQSPLPRSDALGEHPGLRITILLPAEDAIADA