Protein Info for Dshi_0424 in Dinoroseobacter shibae DFL-12

Annotation: peptidase M41 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00122: E1-E2_ATPase" amino acids 12 to 65 (54 residues), 26 bits, see alignment E=6.6e-10 PF01434: Peptidase_M41" amino acids 75 to 134 (60 residues), 39.5 bits, see alignment E=5.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0424)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN29 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Dshi_0424 peptidase M41 (RefSeq) (Dinoroseobacter shibae DFL-12)
MATGTEERVYSWDITSVAANLHVDEAVLTGESVPVRKQTDPVAAEAVVAECCNMAFKGSS
VTQQSSFLEGQAPRYIARSYSEATAEAMDAAVRGVLREVSDEALEILTQNRDILETSARR
LLEVETLDEAELRDLARGLSVDISTENKGAVNE