Protein Info for Dshi_0419 in Dinoroseobacter shibae DFL-12

Annotation: major facilitator superfamily MFS_1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF07690: MFS_1" amino acids 5 to 142 (138 residues), 46.4 bits, see alignment E=2.8e-16 amino acids 209 to 385 (177 residues), 71.7 bits, see alignment E=5.4e-24 PF00083: Sugar_tr" amino acids 32 to 143 (112 residues), 23.6 bits, see alignment E=2.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0419)

Predicted SEED Role

"Transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN24 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Dshi_0419 major facilitator superfamily MFS_1 (RefSeq) (Dinoroseobacter shibae DFL-12)
MRSLLTATVALMAGNGLLGVVLPLRMEAAEYPVALTGAIMAAYYLGLALGGFRAKRVILR
IGHIRAFAAFAALTSTVCLAYAFFFNPAAWVLLRVINGFCIAGMTTTIESWLNERSSNAT
RGRVLGYYMLAFYLAIALGQTLVNVAPVNGDDHLMIAAALIGLSLVPVAMTRLGEPDLRE
VRSLGVGDLYAASKVGVVGASVAGILVGSFYALAMVFARQIGLGVTEAALFMSTVVIGGL
AAQVPVGMLADRFDRRIVMACILLAVGLSWGLLSGAITNGGVPLAVLVVMALAFGGAISS
VYPLCVAQTFDRLDRRAYVAASGRLLMIYSIGATIGPLLASALMSVYGPRSFFLFESALA
MAYACFVLLRVVTGAKPPAAGEREKYVPLPDTSAVASALDPRTEPEPEPVAQPDPKP