Protein Info for Dshi_0359 in Dinoroseobacter shibae DFL-12

Annotation: lipoprotein signal peptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 62 to 82 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 4 to 148 (145 residues), 85.8 bits, see alignment E=1.6e-28 PF01252: Peptidase_A8" amino acids 8 to 148 (141 residues), 111.9 bits, see alignment E=1.6e-36

Best Hits

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to dsh:Dshi_0359)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.36

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMD1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Dshi_0359 lipoprotein signal peptidase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRALALSAVVAFAIDQLSKLVVVHWLNLKEIRAIDVLPPVLNFRMGWNHGVNFGLFGSDS
EAMRWALIVLALAICAGVVIWVRREGGGTRVMVSAGLLVGGALANVLDRVIYGAVADFLN
VSCCGIRNPFTFNLADVAIFAGALGLVLFTGKTDENPS