Protein Info for Dshi_0321 in Dinoroseobacter shibae DFL-12

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00005: ABC_tran" amino acids 33 to 181 (149 residues), 138 bits, see alignment E=5.1e-44

Best Hits

Swiss-Prot: 84% identical to BZTD_RHOCB: Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD (bztD) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K09972, general L-amino acid transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to dsh:Dshi_0321)

MetaCyc: 61% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate/glutamine/aspartate/asparagine ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM93 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Dshi_0321 ABC transporter related (RefSeq) (Dinoroseobacter shibae DFL-12)
MAMTDQAPAMTVSDEVAIEIDKMNKWYGQFHVLRDINLTVYRGERIVICGPSGSGKSTLI
RCINALEEHQAGSITVDGTLLSSDLKNIDTIRSEVGMCFQHFNLFPHLTILENCTLAPIW
VRKTPKKEAEATAMHFLEKVKIPDQANKYPGQLSGGQQQRVAIARSLCMRPRIMLFDEPT
SALDPEMIKEVLDTMIELAEEGMTMICVTHEMGFARQVANRVIFMDAGQIVEQNEPEEFF
GNPQSDRTKLFLSQILGH