Protein Info for Dshi_0271 in Dinoroseobacter shibae DFL-12

Annotation: ribosomal protein S12 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 123 (123 residues), 223.6 bits, E=2.4e-71
• PF00164: Ribosom_S12_S23
  • amino acids 12 to 123 (112 residues), 142.7 bits, E=1.9e-46

Best Hits

Swiss-Prot: 100% identical to RS12_DINSH: 30S ribosomal protein S12 (rpsL) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 96% identity to rsp:RSP_1710)

MetaCyc: 78% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Sequence Analysis Tools

See A8LM43 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Dshi_0271 ribosomal protein S12 (RefSeq) (Dinoroseobacter shibae DFL-12)
MPTIQQLIRKPRQPKVKRSKSQHLESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNG
FEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAK
RPK