Protein Info for Dshi_0261 in Dinoroseobacter shibae DFL-12

Annotation: ribosomal protein L1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR01169: ribosomal protein uL1" amino acids 3 to 227 (225 residues), 327 bits, see alignment E=2.7e-102 PF00687: Ribosomal_L1" amino acids 31 to 220 (190 residues), 237.8 bits, see alignment E=4.3e-75

Best Hits

Swiss-Prot: 100% identical to RL1_DINSH: 50S ribosomal protein L1 (rplA) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K02863, large subunit ribosomal protein L1 (inferred from 100% identity to dsh:Dshi_0261)

MetaCyc: 54% identical to 50S ribosomal subunit protein L1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L1p (L10Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLK0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Dshi_0261 ribosomal protein L1 (RefSeq) (Dinoroseobacter shibae DFL-12)
MAKLGKRTRAAREAVAGKSDLTVEEAVALIKANATSKFDETVEIAMCLGVDPRHADQMVR
GVVSLPNGTGKTVRVAVFARGPKAEEAQAAGADIVGAEDLMETIQSGKIEFDRCIATPDM
MPIVGRLGKILGPRNLMPNPKVGTVTMDVKAAVEAAKGGEVQFKAEKAGVVHAGVGKASF
DEAKLVENVRAFVDAVSKAKPSGAKGSYMKKIALSSTMGPGVTVAVDSATGN