Protein Info for Dshi_0254 in Dinoroseobacter shibae DFL-12

Annotation: ribonuclease T2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00445: Ribonuclease_T2" amino acids 28 to 192 (165 residues), 54.5 bits, see alignment E=8.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0254)

Predicted SEED Role

"Ribonuclease T2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLJ3 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Dshi_0254 ribonuclease T2 (RefSeq) (Dinoroseobacter shibae DFL-12)
MLRCVLCLCLLLAAPATARADGDQAGEFDYYVLALSWSPNWCLREGDDRDAPECAPGAGR
GWTLHGLWPQYETGWPSDCRTTASDPSRAMTRAMTDIMGSAGLAWHQWKKHGRCSGLSAA
DYFAASRRAYESVTRPEILRQLDRDVTLPAAVVEEAFLRENPDWDADMLTITCRDRQIQE
ARLCLTRDLEPRRCGADVLRDCTLQDALLTPLR