Protein Info for Dshi_0164 in Dinoroseobacter shibae DFL-12

Annotation: lytic murein transglycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 25 to 318 (294 residues), 319.3 bits, see alignment E=1.2e-99 PF13406: SLT_2" amino acids 26 to 314 (289 residues), 285.4 bits, see alignment E=4.8e-89 PF01471: PG_binding_1" amino acids 334 to 389 (56 residues), 52.2 bits, see alignment 5.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0164)

Predicted SEED Role

"FIG004335: Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKS0 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Dshi_0164 lytic murein transglycosylase (RefSeq) (Dinoroseobacter shibae DFL-12)
MLRFSLLLLLSFGLAGPVAAQCGGSFSDFVAGLKTEAQAKGHAKATVDAFFRTAAQDPRT
LRADRAQGVFKMPFTEFARRVISQNRMDNGRRNADRFDAVFDAAETRFGVPRGVLLALWA
LETDYGAVQGDFNTLNSLVTLAHDCRRPELFRPQIFAALELYEAGDFDPARTTGAWAGEI
GMVQMLPEDILTKGIDGDGDGHVYLKTSAPDALLSGANMLSGLGWRKGEPWLQEVSVPAD
LDWAETGLNSRKSGRDWARLGVTPRWGEIAGGLEAALILPQGRKGPAFLAYPNFDVFFEW
NQSFVYVTTAAYFATRLSGAPVFDAGNPEPGLNDAQMKQLQQKLAARGYDVGAVDGILGA
RTRAAVRAEQQRLGLPADAWPTPALLGRL