Protein Info for Dshi_0156 in Dinoroseobacter shibae DFL-12

Annotation: LrgB family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details PF04172: LrgB" amino acids 22 to 234 (213 residues), 256.8 bits, see alignment E=7.1e-81

Best Hits

Swiss-Prot: 40% identical to YOHK_SHIFL: Inner membrane protein YohK (yohK) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0156)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKR2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Dshi_0156 LrgB family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTELSAIWVYLSSEPLLWLTATLAAYVAGDALSKLSGRAPLVNPVLVAVALLALVLWASG
TAYDTYFEGAQFVHFMLGPATVALAAPLHANLAKVRRAALPMIAALFAGSLAAMATAVGV
GYALGLRGEVLMSLAPKSATAPVALGIAENIGGLPTLTAVLVILTGIIGAVAATPLLNLL
RIRDWRARGFAVGVAAHGIGTARAFQVNETAGAFAGIGMGVNAVLTAVLAPLLLGLIF