Protein Info for Dshi_0099 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF13401: AAA_22" amino acids 41 to 163 (123 residues), 41.9 bits, see alignment E=1.8e-14 PF09077: Phage-MuB_C" amino acids 174 to 245 (72 residues), 77.8 bits, see alignment E=6.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0099)

Predicted SEED Role

"Putative DNA transposition protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKK5 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Dshi_0099 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MAEHLQLINPGSVPPPAGMVMTETASNILRSLRLVADEPGTLTMVAGVPGVGKSETLRRY
THESKNAQMFTMVAGEGRIWDLANVMMERLELGAPNSRRLREDRYRIMDAIGAEQVVIFD
EAQYLANYNPRGGFNFDAYEWVRAMAEEACFSVVFCGDLSLADTISSVPQLRRRMVRPVV
IRSVPKPDVLAVVRSRGITDPAICDALSVMARRYGGLADVQRTLAQAAKHASSDKIAASD
VKAAMLYLGLSGQGGF