Protein Info for Dshi_0084 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details amino acids 24 to 25 (2 residues), see Phobius details transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details PF03729: DUF308" amino acids 5 to 75 (71 residues), 30.7 bits, see alignment E=1.5e-11 amino acids 62 to 130 (69 residues), 34.5 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0084)

Predicted SEED Role

"Mll8244 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKJ0 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Dshi_0084 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MKWALLGLLSLVCGVIVLGNTVLASIAVTGLTGALFLIAGGAQIVGGLGEEGFGSKAFSI
GMGVLAAFLGLSFLFNPLQGAISLALLITILLAVSGGARIVFAWTMKQTQFFWPMLISGA
LSILLAAYIMANFATASVQLLGVLLGVELLFNGMGFVVLGFFLRSHPELAKPKKD