Protein Info for Dshi_0063 in Dinoroseobacter shibae DFL-12

Annotation: Inositol-phosphate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00459: Inositol_P
  • amino acids 6 to 256 (251 residues), 164.1 bits, E=2.5e-52

Best Hits

KEGG orthology group: K01092, myo-inositol-1(or 4)-monophosphatase [EC: 3.1.3.25] (inferred from 100% identity to dsh:Dshi_0063)

Predicted SEED Role

"FIG043197: Inositol monophosphatase family protein" in subsystem Lipopolysaccharide-related cluster in Alphaproteobacteria

MetaCyc Pathways

• myo-inositol biosynthesis (1/2 steps found)
• D-myo-inositol (1,4,5)-trisphosphate degradation (1/3 steps found)
• superpathway of D-myo-inositol (1,4,5)-trisphosphate metabolism (1/6 steps found)
• phytate degradation I (3/14 steps found)

KEGG Metabolic Maps

• Inositol phosphate metabolism
• Phosphatidylinositol signaling system
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.25

Use Curated BLAST to search for 3.1.3.25

Sequence Analysis Tools

See A8LJY6 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Dshi_0063 Inositol-phosphate phosphatase (RefSeq) (Dinoroseobacter shibae DFL-12)
MPAPDLALLIDAAQAAGRIAEKHWRQDPEAWDKAGGAGPVTEADLEVDRMLRTELLAARP
DYGWLSEETEDTPDRLDRERVFVVDPIDGTRSFMAGQRTFAHALAVVENGIPVAGVVYLP
LRDKLYTAARGAGAALNGTVLRISTRSEVAGATVLAARPNLEGHHWGGTPPALDRHFRSS
LAYRLALTGEGRFDAMLTLRNSWEWDIAAGCLIVEEAGGQTTDRHGAGLRFNNPSAQTKG
VVAANPRLHAELSAKLTSMSERSS