Protein Info for BT4774 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved protein found in conjugate transposon (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details TIGR03782: Bacteroides conjugative transposon TraJ protein" amino acids 7 to 328 (322 residues), 581.6 bits, see alignment E=1.9e-179 PF07863: CtnDOT_TraJ" amino acids 8 to 332 (325 residues), 395.8 bits, see alignment E=8e-123

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4774)

Predicted SEED Role

"Conjugative transposon protein TraJ" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YF8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>BT4774 conserved protein found in conjugate transposon (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MILLSIDWTNLHELLRSLYDEMMPLCEDMASVAKGVAGIGALFYVAYRVWQSLSRAEEID
VFPLFRPFVLGLCIMFFPTMVLGTINGILSPVCSATSSLVEQQTFDMKKYQEEKDELERE
AMLRDPAKAFLVSDEEFDKKIDELGWSLGDMDTMINMYGQKAVYDMGEKVRQWFRELLEL
FFQAASLLIDTLRTFFLIVLSILGPISFALAVYDGFQSTLTTWLSRYICIYLWLPVGDLF
GAILSRIQVLMLQQDIKQMQDPTFIPDASNSVYCIFMIIGIIGYFCVPTVSSWIIQAGGA
GAYGQKVGGAGKMAGNGAAAVGGAVGGSVAGRIKKMF