Protein Info for BT4691 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF05971: Methyltransf_10" amino acids 1 to 306 (306 residues), 391.9 bits, see alignment E=1e-121

Best Hits

Swiss-Prot: 100% identical to RLMF_BACTN: Ribosomal RNA large subunit methyltransferase F (rlmF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06970, ribosomal RNA large subunit methyltransferase F [EC: 2.1.1.181] (inferred from 100% identity to bth:BT_4691)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.181 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YP0 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BT4691 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAERSELHTRNKHNGQYDFSLLTENYPPLRKFVLLNPLGIQTIDFFNPHAVKALNKALLI
SYYGIRYWDIPRNYLCPPIPGRADYVHYIADLIDPERVSNTANEENGDKPKRQCRCLDIG
VGANCIYPIIGHVEYGWMFVGSDIDPVSIENARKIVTCNPVLAHKIDLRLQKDNRRIFDG
IIAPDEYFDVTICNPPFHSSKKEAEEGTLRKLSSLKGEKVKKTKLNFGGNANELWCEGGE
LRFLLNMISESRKYRKNCGWFTSLVSKEKNLDKLYAKLKAVHVSEYKIIRMCQGTKNSRI
LAWRFLE