Protein Info for BT4584 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative aminomethyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR00528: glycine cleavage system T protein" amino acids 2 to 360 (359 residues), 393.2 bits, see alignment E=5.1e-122 PF01571: GCV_T" amino acids 7 to 260 (254 residues), 301.7 bits, see alignment E=3.6e-94 PF08669: GCV_T_C" amino acids 282 to 359 (78 residues), 81.9 bits, see alignment E=2.5e-27

Best Hits

Swiss-Prot: 100% identical to GCST_BACTN: Aminomethyltransferase (gcvT) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 100% identity to bth:BT_4584)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YZ6 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BT4584 putative aminomethyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKTTPFTEKHIALGAKMHEFAGYNMPIEYSGIIDEHLTVCNAVGVFDVSHMGEFWVKGPQ
ALAFLQKVTSNNVAALVPGKIQYTCFPNEEGGIVDDLLVYCYEPEKYLLVVNAANIEKDW
NWCVSHNTEGAELENSSDNMAQLAVQGPKAILALQKLTDIDLSAIPYYTFTVGRFAGKEN
VIISNTGYTGAGGFELYFYPDAAEAIWKAVFEAGEEFGIKPVGLGARDTLRLEMGFCLYG
NDLDDKTSPIEAGLGWITKFVEGKEFINRPMLEKQKSEGTTRKLVGFEMIDRGIPRHGYE
LVNEEGEGIGVVTSGTMSPTRKIGIGMGYVKPEYAKVGTEICIDMRGRKLKAIVVKPPFR
K