Protein Info for BT4499 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein, putative membrane protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 77 (29 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 397 to 416 (20 residues), see Phobius details amino acids 422 to 439 (18 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 22 to 410 (389 residues), 182.7 bits, see alignment E=5.3e-58 PF01554: MatE" amino acids 22 to 181 (160 residues), 107.9 bits, see alignment E=6.3e-35 amino acids 244 to 404 (161 residues), 64 bits, see alignment E=2.1e-21 PF03023: MurJ" amino acids 85 to 240 (156 residues), 29 bits, see alignment E=6.7e-11 PF14667: Polysacc_synt_C" amino acids 137 to 257 (121 residues), 53 bits, see alignment E=6.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4499)

Predicted SEED Role

"conserved hypothetical protein, putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89Z78 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BT4499 conserved hypothetical protein, putative membrane protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MATSKEMTAGPALPLIFNFTLPLLFGNLLQQTYSLVDAAIVGKFLGINALASVGASTSVV
FLILGFCNGCCGGFGIPVAQKFGARDYSTMRSYVSVSLQLAVVMSVVIAIFTSIYCADIL
KMMRTPENIFEGAYAYLLVTFIGIPCTFFYNLLSSIIRALGDSKTPFYFLVLATVLNIIL
DLFCILVLGWGVMGAAIATVFSQGVSAFLCYVYMYRKFDILRGTPKERKYQSKLAKTLLS
IGVPMGLQFSITAIGSIMLQSANNALGTACVAAFTSAMRIKMFFLCPLESLGMAMATFSG
QNYGAGKPERIWSGIKASTLMMVIYTAVTFLILMLGAKSFALIFVDPSEIEILEKTELFL
HISVSFFPMLGLLCILRYTIQGVGYTNLAMFSGVSEMIARILVSIYAVPAFGFIAVCYGD
PMAWIAADLFLIPAFIYVYRRLKRQVLTSVVA