Protein Info for BT4493 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative sugar nucleotide epimerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF01370: Epimerase" amino acids 3 to 211 (209 residues), 59.7 bits, see alignment E=6.2e-20 TIGR01777: TIGR01777 family protein" amino acids 3 to 280 (278 residues), 261.9 bits, see alignment E=4.3e-82 PF08338: DUF1731" amino acids 239 to 280 (42 residues), 48.6 bits, see alignment 1e-16 PF08212: Lipocalin_2" amino acids 293 to 436 (144 residues), 166.9 bits, see alignment E=5.9e-53 PF00061: Lipocalin" amino acids 300 to 430 (131 residues), 33.1 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K07071, (no description) (inferred from 100% identity to bth:BT_4493)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89Z84 at UniProt or InterPro

Protein Sequence (437 amino acids)

>BT4493 putative sugar nucleotide epimerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNIAMTGATGYIGKHLSNYLTEKGGHRIIPLGRAMFREGMSGLLVQTLTHCDVIINLAGA
PINQRWTPEHKQELFNSRITVTHRIIRALNAVKTKPKLMISASAVGYYPSLVESDEYTQT
RGDGFLSDLCYAWEKEAKRCPQPTRLVITRFGVVLSPDGGAMQQMLRPLRATKVAAVIGP
GTQPFPWIDIRDLCCAMAFFIENEELRGVFNLVAPQAVSQSTFTRAMGKAYHAWTTLIVP
QAVFRLFYGEAASFLTAGQRVRPTRLLEAGFHFSVPTIEKLFEGTDHSTVDRLDLKRYMG
LWYEIARYDHRFERGLMEVTATYTLRPDGTIRVENRGYKRNSPYDICRTATGHAKIPDPA
QPGKLKVSFFLNFYSDYYVMELDQENYNYALIGSSTDKYLWILSRTPQLPEDIKKKLVTA
AERRGYDTNRLQWIEQL