Protein Info for BT4473 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative purine permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 410 to 433 (24 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 12 to 432 (421 residues), 384.2 bits, see alignment E=8e-119 PF00860: Xan_ur_permease" amino acids 18 to 401 (384 residues), 307.3 bits, see alignment E=6.8e-96 TIGR03173: xanthine permease" amino acids 22 to 433 (412 residues), 457.9 bits, see alignment E=2.8e-141

Best Hits

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 100% identity to bth:BT_4473)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZA4 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BT4473 putative purine permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKTDLIYGVEDRPPFKDALFAALQHLLAIFVAIITPPLIIASALKLDVEKTSFLVSMSLF
ASGVSTFIQCRRIGPIGAKLLCIQGTSFSFIGPIIATGLVGGLPLIFGSCIAAAPIEMVV
SRTFKYLRNIITPLVSGIVVLLIGLSLIKVGIVSCGGGYSAMDDGSFGSWENLSIAALVL
LSVLFFNRCKNKYLRMSSIVFGLCLGYGLAFALGKVNMSALNVEMLMSFNIPQPFKYGID
FNISSFIAIGLVYLITAIEATGDVTANSMISGLPIEGDSYLKRVSGGVMADGFNSLLAGI
FNSFPNSIFAQNNGIIQLTGVASRYVGYYIAAMLVLLGLFPIVGAIFSLMPDPVLGGATL
LMFGTVAAAGIRIVSSQEIGRKETLVLAVSLSLGLGVELMPDVLKQAPEAIRSIFSSGIT
TGGLTAIVANMVIRVK