Protein Info for BT4415 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative decarboxylase beta subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 238 to 264 (27 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details PF03977: OAD_beta" amino acids 27 to 400 (374 residues), 362.6 bits, see alignment E=1.1e-112 TIGR01109: sodium ion-translocating decarboxylase, beta subunit" amino acids 28 to 396 (369 residues), 202.2 bits, see alignment E=6.1e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4415)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZG2 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BT4415 putative decarboxylase beta subunit (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MENIDFATLFQGIGTMMESGWLLASARVFLVLLGLLLIYLGWKGVLEPMVMIPMGLGMVA
INCGTLMMPDGTLGNLFLDPMLSDTDDLMNTMQIDFLQPVYTLTFSNGLIACFVFMGIGT
LLDVGFLLQKPFASIFLALCAELGTFLTVPIASALGLTLKESASVAMVGGADGPMVLFTS
LALAKHLFVPITVVAYLYLGLTYGGYPYLVKLLVPKRFRAIKMVTKKAPKNYDAKVKLAF
SAVLCAVLCFLFPVASPLFFSLFLGVAVRESGMKHIYDFVSGPLLYGSTFMLGVLLGVLC
DAHLLLDPKILKLLVLGIVALLLSGIGGIIGGYIMYIVKRGNYNPVVGIAAVSCVPTTAK
VAQKIVSKDNPDSFVLGDALGANISGVITSAIITGIYITIIPYL