Protein Info for BT4388 in Bacteroides thetaiotaomicron VPI-5482

Annotation: GTP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR02729: Obg family GTPase CgtA" amino acids 6 to 328 (323 residues), 424.8 bits, see alignment E=1e-131 PF01018: GTP1_OBG" amino acids 7 to 161 (155 residues), 199.1 bits, see alignment E=5e-63 PF01926: MMR_HSR1" amino acids 164 to 284 (121 residues), 87.8 bits, see alignment E=8.2e-29 PF02421: FeoB_N" amino acids 165 to 260 (96 residues), 37.8 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 100% identical to OBG_BACTN: GTPase Obg (obg) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03979, GTP-binding protein (inferred from 100% identity to bth:BT_4388)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZI9 at UniProt or InterPro

Protein Sequence (388 amino acids)

>BT4388 GTP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAESNFVDYVKIYCRSGKGGRGSTHMRREKYCPNGGPDGGDGGRGGHIILRGNRNYWTLL
HLKYDRHAMAGHGESGSKNRSFGKDGADKVIEVPCGTVVYNAETGEYLCDVTDDGQEVIL
LKGGRGGQGNSHFKTATRQAPRFAQPGEPMQEMTVIMELKLLADVGLVGFPNAGKSTLLS
AISAAKPKIADYPFTTLEPNLGIVSYRDGKSFVMADIPGIIEGASQGKGLGLRFLRHIER
NSLLLFMVPADSDDIRKEYEVLLNELRTFNPEMLDKQRVLAITKSDMLDQELMDEIEPTL
PEGVPHIFISSVSGLGISVLKDILWEELNKESNKIEDIVHRPKDVTRLQQELKDMGEDEE
LDYEYEEDADDEDDDLDYEYEEEDWEEK