Protein Info for BT4374 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 7 to 327 (321 residues), 370.2 bits, see alignment E=5.4e-115 PF04166: PdxA" amino acids 34 to 324 (291 residues), 374.3 bits, see alignment E=2.2e-116

Best Hits

Swiss-Prot: 100% identical to PDXA_BACTN: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 100% identity to bth:BT_4374)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZK3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>BT4374 4-hydroxythreonine-4-phosphate dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEENKIRIGITQGDINGVGYEVILKTFSDPTMLELCTPIIYGSPKVAAYHRKALDVQANF
SIVNTASEAGYNRLSVVNCTDDEVKVEFSKPDPEAGKAALGALERAIEEYREGLIDVIVT
APINKHTIQSEEFSFPGHTEYIEERLGNGNKSLMILMKNDFRVALVTTHIPVREIATTIT
KELIQEKLMIFHRCLKQDFGIGAPRIAVLSLNPHAGDGGLLGMEEQEIIIPAMKEMEEKG
IICYGPYAADGFMGSGNYTHFDGILAMYHDQGLAPFKALAMEDGVNYTAGLPVVRTSPAH
GTAYDIAGKGLASEDSFRQAIYVAIDVFRNRQREKAARVNPLRKQYYEKRDDSDKLKLDT
VDED