Protein Info for BT4330 in Bacteroides thetaiotaomicron VPI-5482

Annotation: xanthosine permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details TIGR00889: nucleoside transporter" amino acids 1 to 412 (412 residues), 528.4 bits, see alignment E=7.4e-163 PF03825: Nuc_H_symport" amino acids 1 to 409 (409 residues), 459.1 bits, see alignment E=2e-141 PF12832: MFS_1_like" amino acids 6 to 372 (367 residues), 82.7 bits, see alignment E=4.5e-27 PF07690: MFS_1" amino acids 232 to 409 (178 residues), 40.4 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 60% identical to XAPB_ECOLI: Xanthosine permease (xapB) from Escherichia coli (strain K12)

KEGG orthology group: K11537, MFS transporter, NHS family, xanthosine permease (inferred from 100% identity to bth:BT_4330)

MetaCyc: 60% identical to xanthosine:H+ symporter XapB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-31

Predicted SEED Role

"Nucleoside permease NupG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZP6 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BT4330 xanthosine permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSIKVRLIIMNFLQFFVWGSWLISLGGYMGRELHFEGGQIGAIFATMGIASLVMPGIIGI
IADKWFNAERLYGLCHIAGAACLFYASTVTNYDQMYWAMLLNLLVYMPTLSLANTVSYNA
LEQYKCDLIKDFPPIRVWGTIGFICAMWAVDLTGFKNSSAQLYVGGASALLLGLYSFTLP
ACKPAKTEKKTLLSSFGLDAFVLFKRKKMAIFFLFSMLLGAALQITNTYGDLFLGSFASI
PEFADSFGVKHSVILLSISQMSETLFILAIPFFLRHFGIKQVMLISMFAWVFRFGLFGFG
DPGSGLWMLILSMIVYGMAFDFFNISGSLFVEQETSSSIRASAQGLFFMMTNGLGAIIGG
YASGAVVDAFSVYADGKLVSREWPDIWFIFAAYALVIGILFALVFKYKHQRENKVN