Protein Info for BT4314 in Bacteroides thetaiotaomicron VPI-5482
Annotation: 50S ribosomal protein L21 (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL21_BACTN: 50S ribosomal protein L21 (rplU) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 100% identity to bth:BT_4314)Predicted SEED Role
"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q89ZR2 at UniProt or InterPro
Protein Sequence (105 amino acids)
>BT4314 50S ribosomal protein L21 (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482) MYAIVEINGQQFKAEAGQKLFVHHIEGAENGSTVEFEKVLLVDKDGNVTVGAPTVEGAKV VCQVISNLVKGDKVLVFHKKRRKGYRKLNGHRQQFTELTITEVVA