Protein Info for BT4278 in Bacteroides thetaiotaomicron VPI-5482

Annotation: transposase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 PF13007: LZ_Tnp_IS66" amino acids 42 to 117 (76 residues), 50 bits, see alignment E=5.9e-17 PF03050: DDE_Tnp_IS66" amino acids 185 to 466 (282 residues), 314.9 bits, see alignment E=7.9e-98 PF13817: DDE_Tnp_IS66_C" amino acids 473 to 513 (41 residues), 34.6 bits, see alignment 2.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4278)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (523 amino acids)

>BT4278 transposase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTQTETLELLVATLQQANSSQSESIERLTRQNEQLQNKLQELLAQVAWLNRQLFGRKSEK
LAHLDPNQLSLFDPPVQPLEHEIPEEAAAQEPVCSTTPKKKVRQNRNMLDGLPVVEIVIE
PEGVDPDKYKRIGEERTRTLEFEPGKLYVKEIIRPKYGLKDNISLPQGHQGSVIIAPLPL
LPIYKGLPGASLLTEILLQKYEYHVPFYRQVREFHHLGLKISENTLQGWFKPACELLKPL
YEELKKQVLKADYIQVDETTLPVINKQNHKAVKEYLWIVRAVMDGLVFFHYDDGSRSQET
AWKLLQTFKGYLQSDGYAAYNIFEGKKEVCLVGCLAHIRRHYEVAKEENESLAGYVLAQI
QQLYRIEQIADQEELTYEQRMLRRQEQALPILEQLEKWMETAYPKVLPKSRMGQAIAYAY
QLWPRMRNYLKDGRLKIDNNLAENAIRPIALSRKNFLFCGNHEAAQNTAIICSLLASCKA
SNINPREWLTEVIALLPYYAANKEKDLKELLPHCWESGNSKEL