Protein Info for BT4207 in Bacteroides thetaiotaomicron VPI-5482

Annotation: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 7 to 329 (323 residues), 366 bits, see alignment E=7.3e-114 PF04613: LpxD" amino acids 22 to 90 (69 residues), 72 bits, see alignment E=6e-24 PF00132: Hexapep" amino acids 111 to 144 (34 residues), 40 bits, see alignment 4.3e-14 amino acids 125 to 155 (31 residues), 30.7 bits, see alignment (E = 3.6e-11) amino acids 146 to 180 (35 residues), 37.2 bits, see alignment 3.1e-13 PF14602: Hexapep_2" amino acids 125 to 156 (32 residues), 15.6 bits, see alignment (E = 2.2e-06) amino acids 278 to 301 (24 residues), 14.9 bits, see alignment (E = 3.5e-06)

Best Hits

Swiss-Prot: 100% identical to LPXD_BACTN: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to bth:BT_4207)

MetaCyc: 55% identical to UDP-3-O-(3-hydroxyacyl)glucosamine N-acyltransferase (Porphyromonas gingivalis W50)
RXN-22241 [EC: 2.3.1.191]; 2.3.1.191 [EC: 2.3.1.191]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A014 at UniProt or InterPro

Protein Sequence (346 amino acids)

>BT4207 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEFSAKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLV
NKDFVPEHEIRATLIKVDNAYESLAKLLNLYEMSKPKKQGIDSLAYIAPSAKIGENVYIG
AFAYIGENAVIGDNTQIYPHTFVGDGVKIGNGCLLYSNVNVYHDCRIGNECILHSGAVIG
ADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATIIHSGAKIDNLVQIAH
NDEIGSHTVMAAQVGIAGSAKIGEWCMFGGQVGIAGHITIGDRVNLGAQSGIPSSIKADS
VLIGTPPMEPKAYFKAAVVTKNLPDMQKEIRNLRKEVEELKQLLNK