Protein Info for BT4127 in Bacteroides thetaiotaomicron VPI-5482

Annotation: glucosamine-6-phosphate isomerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00502: glucosamine-6-phosphate deaminase
  • amino acids 1 to 259 (259 residues), 431.3 bits, E=5.8e-134
• PF01182: Glucosamine_iso
  • amino acids 8 to 230 (223 residues), 77 bits, E=9.8e-26

Best Hits

Swiss-Prot: 100% identical to NAGB_BACTN: Glucosamine-6-phosphate deaminase (nagB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 100% identity to bth:BT_4127)

MetaCyc: 65% identical to glucosamine-6-phosphate deaminase (Escherichia coli K-12 substr. MG1655)
Glucosamine-6-phosphate deaminase. [EC: 3.5.99.6]

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (3/8 steps found)
• chitin degradation I (archaea) (2/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.99.6

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See Q8A094 at UniProt or InterPro

Protein Sequence (270 amino acids)

>BT4127 glucosamine-6-phosphate isomerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MRLIIQPDYQSVSQWAAHYVAAKIKAANPTPEKPFVLGCPTGSSPLGMYKALIDLNKKGI
VSFQNVVTFNMDEYVGLPKEHPESYYSFMWNNFFSHIDIKKENTNILNGNAPDLDAECAR
YEEKIKSYGGIDLFMGGIGPDGHIAFNEPGSSLTSRTRQKTLTTDTIIANSRFFDNDINK
VPKTALTVGVGTVLSAKEVMIIVNGHNKARALYHAVEGSITQMWTISALQMHEKGIIVCD
DAATEELKVGTYRYFKDIEAGHLDPESLIK