Protein Info for BT4099 in Bacteroides thetaiotaomicron VPI-5482

Annotation: 1-deoxy-D-xylulose 5-phosphate synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 10 to 287 (278 residues), 357.5 bits, E=6.9e-111
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 11 to 631 (621 residues), 725.2 bits, E=3.3e-222
• PF02779: Transket_pyr
  • amino acids 329 to 486 (158 residues), 134.3 bits, E=5.7e-43
• PF02780: Transketolase_C
  • amino acids 503 to 624 (122 residues), 77.7 bits, E=1.1e-25

Best Hits

Swiss-Prot: 100% identical to DXS_BACTN: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to bth:BT_4099)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• isoprene biosynthesis I (6/10 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.7

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See Q8A0C2 at UniProt or InterPro

Protein Sequence (647 amino acids)

>BT4099 1-deoxy-D-xylulose 5-phosphate synthase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNEPIYNLLNSINSPDDLRRLEVDQLPEVCDELRQDIIKELSCNPGHFAASLGTVELTV
ALHYVYNTPYDRIVWDVGHQAYGHKILTGRREAFSTNRKLGGIRPFPSPEESEYDTFTCG
HASNSISAALGMAVAAAKKGDDQRHVIAIIGDGSMSGGLAFEGLNNSSTTPNNLLIILND
NDMAIDRSVGGMKQYLFNLTTSNRYNQLRFKASRLLFKLGILNDERRKALIRFGNSLKSM
AAQQQNIFEGMNIRYFGPIDGHDIKNLSRVLRDIKDLKGPKILHLHTIKGKGFAPAEKHA
TEWHAPGKFDPVTGERFVANTEGMPPLFQDVFGNTLVELAEANPRIVGVTPAMPSGCSMN
ILMSKMPKRAFDVGIAEGHAVTFSGGMAKDGLQPFCNIYSSFMQRAYDNIIHDVAIQNLP
VVLCLDRAGLVGEDGPTHHGAFDMAYLRPIPNLTIASPMNEHELRRLMYTAQLPDKGPFV
LRYPRGRGVLVDWKCPLEEIPVGKGRKLKDGKDIAVISIGPIGNKARSAIARAESESGRS
IAHYDLRFLKPLDEELLHEVGRTFRHIVTIEDGTIQGGMGSAVLEFMADHEYTPTVKRIG
IPDKFVQHGTVAELYQLCGMDEDSLTKELLKQCELLPDMSKIKELTN