Protein Info for BT4098 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Trk system K+ uptake protein trkA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF03435: Sacchrp_dh_NADP" amino acids 3 to 84 (82 residues), 25.2 bits, see alignment E=3.6e-09 PF02254: TrkA_N" amino acids 3 to 123 (121 residues), 84.2 bits, see alignment E=1.8e-27 amino acids 232 to 347 (116 residues), 73.2 bits, see alignment E=4.6e-24 PF02080: TrkA_C" amino acids 164 to 220 (57 residues), 27.3 bits, see alignment 5.4e-10 amino acids 378 to 445 (68 residues), 41.1 bits, see alignment E=2.8e-14

Best Hits

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to bth:BT_4098)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A0C3 at UniProt or InterPro

Protein Sequence (446 amino acids)

>BT4098 Trk system K+ uptake protein trkA (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKIIIAGAGNVGTHLAKLLSREKQDIILMDDDEEKLSALSANFDLLTVTASPSSISGLKE
VGVKEADLFIAVTPDESRNMTACMLATNLGAKKTVARIDNYEYLLPKNKEFFRKLGVDSL
IYPEMLAAKEIVSSMRMSWVRQWWEFCGGALILIGTKMREKAEILNIPLHQLGAPDIPYH
VVAIKRGTETIIPRGDDVIKLHDIVYFTTTRKYIPYIRKIAGKEDYADVRNVMIMGGSRI
AVRTAQYVPDYMQVKIVDNDINRCNRLTELLDDKTMIINGDGRDMDLLIEEGLKNTEAFV
ALTDNSETNILACLAAKRMGVEKTVAEVENIDYIGMAESLDIGTVINKKMIAASHIYQMM
LDADVSNVKCLTFANADVAEFTVPAGAKITKNLIKDLGLPKGTTIGGMIRNGEGVLVTGD
TLIRPGDHVVVFCLSMMIKKIEKFFN